The full dataset viewer is not available (click to read why). Only showing a preview of the rows.
The dataset generation failed
Error code:   DatasetGenerationError
Exception:    ArrowTypeError
Message:      ("Expected bytes, got a 'list' object", 'Conversion failed for column Socs36E with type object')
Traceback:    Traceback (most recent call last):
                File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/packaged_modules/json/json.py", line 137, in _generate_tables
                  pa_table = paj.read_json(
                File "pyarrow/_json.pyx", line 308, in pyarrow._json.read_json
                File "pyarrow/error.pxi", line 154, in pyarrow.lib.pyarrow_internal_check_status
                File "pyarrow/error.pxi", line 91, in pyarrow.lib.check_status
              pyarrow.lib.ArrowInvalid: JSON parse error: Column() changed from object to string in row 0
              
              During handling of the above exception, another exception occurred:
              
              Traceback (most recent call last):
                File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1855, in _prepare_split_single
                  for _, table in generator:
                File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/packaged_modules/json/json.py", line 167, in _generate_tables
                  pa_table = pa.Table.from_pandas(df, preserve_index=False)
                File "pyarrow/table.pxi", line 3874, in pyarrow.lib.Table.from_pandas
                File "/src/services/worker/.venv/lib/python3.9/site-packages/pyarrow/pandas_compat.py", line 611, in dataframe_to_arrays
                  arrays = [convert_column(c, f)
                File "/src/services/worker/.venv/lib/python3.9/site-packages/pyarrow/pandas_compat.py", line 611, in <listcomp>
                  arrays = [convert_column(c, f)
                File "/src/services/worker/.venv/lib/python3.9/site-packages/pyarrow/pandas_compat.py", line 598, in convert_column
                  raise e
                File "/src/services/worker/.venv/lib/python3.9/site-packages/pyarrow/pandas_compat.py", line 592, in convert_column
                  result = pa.array(col, type=type_, from_pandas=True, safe=safe)
                File "pyarrow/array.pxi", line 339, in pyarrow.lib.array
                File "pyarrow/array.pxi", line 85, in pyarrow.lib._ndarray_to_array
                File "pyarrow/error.pxi", line 91, in pyarrow.lib.check_status
              pyarrow.lib.ArrowTypeError: ("Expected bytes, got a 'list' object", 'Conversion failed for column Socs36E with type object')
              
              The above exception was the direct cause of the following exception:
              
              Traceback (most recent call last):
                File "/src/services/worker/src/worker/job_runners/config/parquet_and_info.py", line 1436, in compute_config_parquet_and_info_response
                  parquet_operations = convert_to_parquet(builder)
                File "/src/services/worker/src/worker/job_runners/config/parquet_and_info.py", line 1053, in convert_to_parquet
                  builder.download_and_prepare(
                File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 925, in download_and_prepare
                  self._download_and_prepare(
                File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1001, in _download_and_prepare
                  self._prepare_split(split_generator, **prepare_split_kwargs)
                File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1742, in _prepare_split
                  for job_id, done, content in self._prepare_split_single(
                File "/src/services/worker/.venv/lib/python3.9/site-packages/datasets/builder.py", line 1898, in _prepare_split_single
                  raise DatasetGenerationError("An error occurred while generating the dataset") from e
              datasets.exceptions.DatasetGenerationError: An error occurred while generating the dataset

Need help to make the dataset viewer work? Make sure to review how to configure the dataset viewer, and open a discussion for direct support.

updated
list
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this networ...
[ { "content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: AdSL, CG15631, CG18528, CG2930, CG4617, Fem-1, Sec10, lva, tRNA:Q:34E\n- Network density: approximately 0.22\n- Hub proteins (highly connected): tRNA:Q:34E, CG18528\n- Total interactions: approximate...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: AkhR, CCAP, CCAP-R, CG5890\n- Network density: approximately 0.50\n- Hub proteins (highly connected): CCAP, CG5890\n- Total interactions: approximately 3", "role": "user" }, { "content": ...
[ { "content": "Generate a protein network with the following properties:\n- Proteins: Bcl9l, CTNNB1, Shank3, Yap1\n- Network density: approximately 0.67\n- Hub proteins (highly connected): Bcl9l, CTNNB1\n- Total interactions: approximately 4", "role": "user" }, { "content": "<biopax>\n <proteins>\n ...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this networ...
[ { "content": "Generate a protein network with the following properties:\n- Proteins: K01C8.1, elks-1, glh-1, klp-11\n- Network density: approximately 0.67\n- Hub proteins (highly connected): K01C8.1, glh-1\n- Total interactions: approximately 4", "role": "user" }, { "content": "<biopax>\n <proteins...
[ { "content": "Complete this partial protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"bubr1\" name=\"BubR1\" uniprot=\"F8WLE2\"/>\n <p id=\"cg11380\" name=\"CG11380\" uniprot=\"A0A0M4ER81\"/>\n <p id=\"cg13476\" name=\"CG13476\" uniprot=\"Q7KUL3\"/>\n <p id=\"cg15087\" n...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this partia...
[ { "content": "Complete this partial protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"f15e11.14\" name=\"F15E11.14\" uniprot=\"G5EBF3\"/>\n <p id=\"f26d2.15\" name=\"F26D2.15\" uniprot=\"G5ECL7\"/>\n <p id=\"w09d10.4\" name=\"W09D10.4\" uniprot=\"O18183\" fullname=\"Protein...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this networ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this partia...
[ { "content": "Predict the protein interaction network:\n\nPROTEIN: CG5147\n UniProt ID: A0A0M3QWY8\n Organism: Drosophila busckii\n Sequence Length: 400 amino acids\n Sequence: MPAKKAAAAAAPVAAAANGMTRLTPARDLTLGGRGGAAANKKVFAPNLNAVRNKNTNVKTSKDFTQPRGGRARGGRGSAAGATRGRGGGGNSTLIQTTGVFSEGAGAVHLRKSTSAAGGGGGSSY...INL...
[ { "content": "Predict the protein interaction network:\n\nPROTEIN: dcr-1\n UniProt ID: A0A0C9QPE9\n Organism: Fopius arisanus\n Sequence Length: 1949 amino acids\n Sequence: MAFPFNDQVYTKSFTPREYQVELLYTAKQRDIIICLGKYTEQTFIVTKLIQEFATGNRIPLVSAQRILYLLDSEESCSLKSSYIEQLTDLKVSVIDSTTQDNDFAHIFTSGHVVVTTSAIFYKFV...GRRVRV...
[ { "content": "Predict the protein interaction network:\n\nPROTEIN: CG10077\n UniProt ID: Q8MZI3\n Full Name: RNA helicase\n Organism: Drosophila melanogaster\n Sequence Length: 818 amino acids\n Sequence: MNMYNGQMNAFGGGGGGGAGGLAGGMVPNRMGGGAPGGGPGGAGMFQRNRSAPYPGFNGHGPANGGQRRMNGGGPSMGPGGPRNQDGFGGQNGGQRSSNHGA...
[ { "content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: SPAC644.07, SPAP27G11.14c, cbp3, coq7, cyt1, pgr1, ppr1, ppr4, ppr8, sls1\n- Network density: approximately 0.20\n- Hub proteins (highly connected): pgr1, ppr8\n- Total interactions: approximately 9"...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this partia...
[ { "content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.", "role": "system" }, { "content": "Generate a protein network with the ...
[ { "content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: NR3C1\n UniProt ID: A1YFI6\n Organism: Saguinus labiatus\n Sequence Length: 50 amino acids\n Sequence: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQLPKYSNGNIRKLLFHQK\n AlphaFold Structure: Available\n Structure Coverage: residues 1-...
[ { "content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.", "role": "system" }, {...
[ { "content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.", "role": "system" }, { "content": "Generate a protein network with the ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "Predict the protein interaction network:\n\nPROTEIN: CG10510\n UniProt ID: Q95U04\n Full Name: Dynein regulatory complex subunit 2\n Organism: Drosophila melanogaster\n Sequence Length: 523 amino acids\n Sequence: MAEILARLTRVSENYLQELEEEPEPQGPPKLTKAQKKAAKKEAKRLAMIEEKRLIMRDALMRELEMGKHMEEKGNEEWH...
[ { "content": "Known protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"cg11321\" name=\"CG11321\" uniprot=\"A0A0M4ENX1\"/>\n <p id=\"cg12362\" name=\"CG12362\" uniprot=\"Q9VT94\" fullname=\"RBR-type E3 ubiquitin transferase\"/>\n <p id=\"ubcd10\" name=\"UbcD10\" uniprot=\"A0...
[ { "content": "Predict the protein interaction network for these proteins in compressed BioPAX format:\n\nPROTEIN: CG13871\n UniProt ID: Q4V5P0\n Organism: Drosophila melanogaster\n Sequence Length: 479 amino acids\n Sequence: PRRPFGSERRDLAPSEQRYFSDPELLFQRLDDMEQKLGIPEKMAAAGKVKSEHYLVGPTNVAAQMLKDNLYKFPIDDGAIGQ...
[ { "content": "Generate a protein network with the following properties:\n- Proteins: CG12672, CG17739, CG6656, Cyp28d1, Cyp28d2\n- Network density: approximately 0.50\n- Hub proteins (highly connected): Cyp28d2, Cyp28d1\n- Total interactions: approximately 5", "role": "user" }, { "content": "<biopax...
[ { "content": "Known protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"cg10859\" name=\"CG10859\" uniprot=\"A0A0M3QZ12\"/>\n <p id=\"cg3713\" name=\"CG3713\" uniprot=\"Q9V3D7\"/>\n <p id=\"cg8219\" name=\"CG8219\" uniprot=\"Q9VRV9\" fullname=\"Importin N-terminal domain-cont...
[ { "content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.", "role": "system" }, {...
[ { "content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.", "role": "system" }, { "content": "Generate a protein network in compre...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this networ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: CG8177\n UniProt ID: Q1PQ27\n Organism: Drosophila miranda\n Sequence Length: 355 amino acids\n Sequence: RRMPMYKSDILDGLNTETLAATIFMYFACLSTAITFGGLVSDKTKSWIGISETLISCSFVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQNDFDFLSLRVYVGIWLIIIALC...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "Generate a protein network with the following properties:\n- Proteins: Dg, Mad, Pdp, Su(var)3-9\n- Network density: approximately 0.67\n- Hub proteins (highly connected): Pdp, Mad\n- Total interactions: approximately 4", "role": "user" }, { "content": "<biopax>\n <proteins>\n <p id...
[ { "content": "Complete this network:\n<biopax>\n <proteins>\n <p id=\"arnt\" name=\"ARNT\" uniprot=\"Q80T29\"/>\n <p id=\"arnt2\" name=\"ARNT2\" uniprot=\"A0A7K4JWC9\"/>\n <p id=\"arntl\" name=\"ARNTL\" uniprot=\"A0A8K0EMB6\"/>\n <p id=\"maged1\" name=\"MAGED1\" uniprot=\"A0AAU9YY36\"/>\n <p id=...
[ { "content": "Generate a protein network with the following properties:\n- Proteins: Akh, AkhR, CCAP, CG11635, CG2865, Crz, Gl\n- Network density: approximately 0.29\n- Hub proteins (highly connected): AkhR, CG11635\n- Total interactions: approximately 6", "role": "user" }, { "content": "<biopax>\n ...
[ { "content": "Complete this network:\n<biopax>\n <proteins>\n <p id=\"cg1598\" name=\"CG1598\" uniprot=\"Q6XIF0\"/>\n <p id=\"cg17327\" name=\"CG17327\" uniprot=\"Q6XHQ9\"/>\n <p id=\"cg3097\" name=\"CG3097\" uniprot=\"A0A0M4F8W7\"/>\n <p id=\"cg4820\" name=\"CG4820\" uniprot=\"A0A0M5JC24\"/>\n ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: CG2224, Mer, Nrx-1, Spn, Tmem173, rictor\n- Network density: approximately 0.53\n- Hub proteins (highly connected): Spn, Nrx-1\n- Total interactions: approximately 8", "role": "user" }, { ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.", "role": "system" }, {...
[ { "content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.", "role": "system" }, {...
[ { "content": "Complete this network:\n<biopax>\n <proteins>\n <p id=\"btbd9\" name=\"Btbd9\" uniprot=\"A0A7K4YNQ0\"/>\n <p id=\"cacna1h\" name=\"Cacna1h\" uniprot=\"A0A812NI47\"/>\n <p id=\"dst\" name=\"Dst\" uniprot=\"A0A8J9W0F9\"/>\n <p id=\"faf1\" name=\"Faf1\" uniprot=\"A0A7K8NE75\"/>\n <p i...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this networ...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this partia...
[ { "content": "You are a protein interaction prediction system. Given a partial protein network in compressed BioPAX format, predict the complete network including missing interactions. Generate the complete network in compressed BioPAX format.", "role": "system" }, { "content": "Complete this networ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: ATbp\n UniProt ID: A0A0M4ES44\n Organism: Drosophila busckii\n Sequence Length: 401 amino acids\n Sequence: MGFPRILSKNNKIYTKLGEFCLSGESFWIVCHTCQEELQTQDAFWKHIQDEHNFLHGVAKQDHSRTSSYCLTDVETATATTGATTAQATGGVTAVSVPLALYHCAAKYSEEEQR...
[ { "content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.", "role": "system" }, { "content": "Generate a protein network with the ...
[ { "content": "You are a protein interaction network generator. Given network constraints and properties, generate a biologically plausible protein network in compressed BioPAX format with <proteins> and <interactions> sections.", "role": "system" }, { "content": "Generate a protein network with the ...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "Predict the protein interaction network:\n\nPROTEIN: Y62E10A.17\n UniProt ID: G2HK15\n Full Name: Transcription factor aptf-2\n Organism: Caenorhabditis elegans\n Sequence Length: 367 amino acids\n Sequence: MDIQMFTTLNSTVPTEPVVGPVEPTVPTVPATKETGPSSSAECSTQPAVAEQEDNSLLAQLLKGKITSDDAKLQPPRGPFEYAPM...
[ { "content": "Predict the protein interaction network:\n\nPROTEIN: CG13373\n UniProt ID: A0A0M4EUE9\n Organism: Drosophila busckii\n Sequence Length: 175 amino acids\n Sequence: MESSSNSLKRMRSEDDESNNNVTQTKVWVNEKINNSRDPDKMKAVHEKTTKMLFKAAANMDNRSESEDSAVPVPAAPTLNLCDQYQLIGDGNIILRDLNPDVANPTLERRISACCQRPTLIRGNCVNCTF...
[ { "content": "Predict the protein interaction network for these proteins:\n\nPROTEIN: CG32364\n UniProt ID: A0A0M4EYT7\n Organism: Drosophila busckii\n Sequence Length: 230 amino acids\n Sequence: MPSMNFDKKYCTSQINGTVYMTTMKNLSEEQLTKLNAGAGEIYLSNIPKKCSAKRIMQVAVKLGEVYMLRNKIDFLRDSRGFAYLQYINETHMKNTMHALQQLFWNAKLGI...
[ { "content": "Predict the protein interaction network:\n\nPROTEIN: CG15308\n UniProt ID: Q9W2X3\n Organism: Drosophila melanogaster\n Sequence Length: 95 amino acids\n Sequence: MKFFIAAFLIAACMALAQCSVIYSPVSSVPVVRSVPVIRSVPVVRSVPVVRRVPVVRRVNVVESVPVVPSVVRVGQAPIYDAPLVQSYGGWLKQK\n AlphaFold Structure: Available\...
[ { "content": "You are a protein interaction prediction system. Given a list of proteins with their sequence and structural information, predict all likely interactions between them in compressed BioPAX format. Use <proteins> with <p> elements and <interactions> with <i> elements.", "role": "system" }, {...
[ { "content": "Known protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"cg15080\" name=\"CG15080\" uniprot=\"A0A0M4EI06\"/>\n <p id=\"cg7158\" name=\"CG7158\" uniprot=\"A0A0M4EN27\"/>\n <p id=\"rab30\" name=\"Rab30\" uniprot=\"Q9VM50\"/>\n <p id=\"sgf11\" name=\"Sgf11\" un...
[ { "content": "Predict the protein interaction network for these proteins in compressed BioPAX format:\n\nPROTEIN: asd-2\n UniProt ID: A8XGG9\n Organism: Caenorhabditis briggsae\n Sequence Length: 397 amino acids\n Sequence: MTHASTEHLTPNGSTNGISTSQQQQYSVEYLSQLLKDKKQLAAFPNVFHHLERLADDEISKVRVALFQFEFTKDNVTLPDAEGD...
[ { "content": "Complete this partial protein network in compressed BioPAX format:\n<biopax>\n <proteins>\n <p id=\"act-5\" name=\"act-5\" uniprot=\"A8XS95\"/>\n <p id=\"agef-1\" name=\"agef-1\" uniprot=\"A8XWC0\"/>\n <p id=\"elb-1\" name=\"elb-1\" uniprot=\"A8XHD3\"/>\n <p id=\"elc-1\" name=\"elc-1\...
[ { "content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: CG10754, CG18522, CG30324, CG31955, Mst84Dd, Sgt, dar1, hale, kn, nudE\n- Network density: approximately 0.27\n- Hub proteins (highly connected): dar1, hale\n- Total interactions: approximately 12", ...
[ { "content": "Generate a protein network in compressed BioPAX format with the following properties:\n- Proteins: CG9593, RpL34b, RpS13, Tequila, mRpL38\n- Network density: approximately 0.40\n- Hub proteins (highly connected): CG9593, RpS13\n- Total interactions: approximately 4", "role": "user" }, { ...
[ { "content": "Predict the protein interaction network for these proteins in compressed BioPAX format:\n\nPROTEIN: CG2678\n UniProt ID: A0A6I8VZQ2\n Organism: Drosophila pseudoobscura pseudoobscura\n Sequence Length: 329 amino acids\n Sequence: MECVCRVCLDGSVPLVDIFAEISDLRLNLYESSPACVISKLAPEHSVVRGDSMPQFICLSCIHG...
[ { "content": "You are a protein interaction prediction system. Given a known protein network in compressed BioPAX format and a new protein with sequence and structural information, predict which proteins in the network the new protein will interact with. Generate the interactions in compressed BioPAX format.", ...
[ { "content": "Predict the protein interaction network:\n\nPROTEIN: C44C10.4\n UniProt ID: Q18616\n Full Name: Structural maintenance of chromosomes-like protein 1\n Organism: Caenorhabditis elegans\n Sequence Length: 537 amino acids\n Sequence: MTYPQQRLLTVDILNFKCYQHHKSFGPFDHVTTFIGMNGCGKSIMIEAIAFVFGEDLPDPKN...
End of preview.